PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00103_0190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family CO-like
Protein Properties Length: 408aa    MW: 44855.1 Da    PI: 7.9144
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00103_0190genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box25.13.5e-08345440
       zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                   + C+ +++++++ +C+ +  +lC+ C   +H+       H++v
  kfl00103_0190  3 KQCDACQSQKATVYCRADVAFLCNGCDRVIHEAnplarrHERV 45
                   68*****************************767777778765 PP

2zf-B_box26.41.5e-084690442
       zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Htvvpl 42
                    +C+ +e  ++   C+ ++ ++C++C  ++H g       H++vp+
  kfl00103_0190 46 FVCEVCETLPAVVNCKADSAFICNNCDNSIH-GanglarrHERVPV 90
                   68*****************************.55789999*99986 PP

3CCT67.92.7e-23320363144
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                    Rea+++RYkeKrk+R +eK+irY+sRKa+AesRpRvKGrF+k++
  kfl00103_0190 320 REARVNRYKEKRKNRTYEKTIRYASRKAYAESRPRVKGRFAKRE 363
                    9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.7E-10147IPR000315B-box-type zinc finger
PROSITE profilePS5011910.168147IPR000315B-box-type zinc finger
PfamPF006431.8E-6345IPR000315B-box-type zinc finger
CDDcd000211.25E-7547No hitNo description
PROSITE profilePS5011910.4244390IPR000315B-box-type zinc finger
CDDcd000215.57E-74690No hitNo description
PfamPF006431.6E-64690IPR000315B-box-type zinc finger
SMARTSM003362.9E-74890IPR000315B-box-type zinc finger
PROSITE profilePS5101716.222320362IPR010402CCT domain
PfamPF062036.1E-18320362IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MPKQCDACQS QKATVYCRAD VAFLCNGCDR VIHEANPLAR RHERVFVCEV CETLPAVVNC  60
KADSAFICNN CDNSIHGANG LARRHERVPV TPFYECQDAV KVAHIHYPPS LVPEGLALEV  120
PQFCREDDDS ALEAASWLLN KPDEGGSRGE EGVDKPDFCP PSQDGQVPSN LCRQPCVKQT  180
KPFELPMLMQ VNGGARVKQE TGMFNPMAEK HRGVKAGPRF GVNPGLMPRA EALVPSLGGS  240
GEVLEQRVPV VQKGKSSFAV PQLAHSVSSS SFDVALVPDS SLSEVSMPSP DADVQKGDTA  300
KGFEMPQRLL HVGGAPPMDR EARVNRYKEK RKNRTYEKTI RYASRKAYAE SRPRVKGRFA  360
KRESNVSITQ GIPVSHIPVS QPFPSYDYSM YGMVPDGLPY GMMPVSYY
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.13e-59CONSTANS-like 2